PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G27770.1
Common NameLOC102710866
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 240aa    MW: 26490.1 Da    PI: 8.7126
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G27770.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.31.5e-1979133256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  OB04G27770.1  79 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTK 133
                   788899***********************************************98 PP

2HD-ZIP_I/II129.21.6e-4179168191
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                   +kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  OB04G27770.1  79 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQKEVQELR-AL 168
                   69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.94E-1972136IPR009057Homeodomain-like
PROSITE profilePS5007117.31375135IPR001356Homeobox domain
SMARTSM003897.4E-1877139IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.6E-1979133IPR009057Homeodomain-like
PfamPF000466.8E-1779133IPR001356Homeobox domain
CDDcd000864.04E-1679136No hitNo description
PRINTSPR000314.2E-6106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000314.2E-6115131IPR000047Helix-turn-helix motif
PfamPF021832.2E-11135169IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.7E-24135179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MMERAEDLRL SLSLSSPLAP RTHHVAAMLF HSPPEKRFLE MPLLPAAKRS EVAAADEERA  60
GLRGGSDEED GGCGIDGSRK KLRLSKDQSA VLEDSFREHP TLNPRQKAAL AQQLGLRPRQ  120
VEVWFQNRRA RTKLKQTEVD CEFLKRCCET LTEENRRLQK EVQELRALKL VSPHLYMNMS  180
PPTTLTMCPS CERVSNANNS SSAAPDRRGA GGVTAAGGND TAADGGILCH RPIAVRPQQS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17783SRKKLRL
2127135RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1220060.0AK122006.1 Oryza sativa Japonica Group cDNA clone:J033110O17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652606.11e-177PREDICTED: homeobox-leucine zipper protein HOX17
SwissprotQ0JB921e-134HOX17_ORYSJ; Homeobox-leucine zipper protein HOX17
TrEMBLJ3M0521e-177J3M052_ORYBR; Uncharacterized protein
STRINGOB04G27770.11e-176(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.19e-73homeobox-leucine zipper protein 3